010-64814275arget Protein
reticulocalbin 3, EF-hand calcium binding domain
Target Gene
RCN3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000019539 (97%)
Rat ENSRNOG00000043007 (97%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.